nysgrc-logo Target details for B037:1 protein structure initiative

 

Target ID B037
Family
Organism Staphylococcus aureus
Description penicillin-binding protein 4 [Staphylococcus aureus]
Modification
Sequence MKNLISIIIILCLTLSIMTPYAQATNSDVTPVQAANQYGYAGLSAAYEPTSAVNVSQTGQ LLYQYNIDTK WNPASMTKLMTMYLTLEAVNKGQLSLDDTVTMTNKEYIMSTLPELSNTK LYPGQVWTIADLLQITVSNSS NAAALILAKKVSKNTSDFVDLMNNKAKAIGMKNTHFVN PTGAENSRLRTFAPTKYKDQERTVTTARDYAI LDLHVIKETPKILDFTKQLAPTTLAVT YYTFNFSLEGAKMSLPGTDGLKTGSSDTANYNHTITTKRGKFR INQVIMGAGDYKNLGG EKQRNMMGNALMERSFDQYKYVKILSKGEQRINGKKYYVENDLYDVLPSDFSKK DYKLV VEDGKVHADYPREFINKDYGPPTVEVHQPIIQKANTVAKSMWEEHPLFTIIGGTCLVAGL ALIVH MIINRLFRKRK
Molecular Weight 48237.36
Target Length 431
Charge 14.5
Number of cysteines 2
Number of Methionine 16
Isoelectric Point 9.6330
MD5 ID (modbase format) 8d2fc2bdcbe689adab1b09fd6ddc16ecMKNLRKRK
Entry Date 2004-06-29
User Name J.Bonanno

 

Home Proposal Publications Flowchart IceDB Contact