nysgrc-logo Target details for L060:1 protein structure initiative

 

Target ID L060
Family
Organism Encephalitozoon cuniculi
Description mRNA capping enzyme
Modification
Sequence MDSSSPLKTFRKDQAMEGKKEEIREHYNSIRERGRESRQRSKTINIRNANNFIKACLIRL YTKRGDSVLDLGCGKGGDLLKYERAGIGEYYGVDIAEVSINDARVRARNMKRRFKVFFR A QDSYGRHMDLGKEFDVISSQFSFHYAFSTSESLDIAQRNIARHLRPGGYFIMTVPSRD VI LERYKQGRMSNDFYKIELEKMEDVPMESVREYRFTLLDSVNNCIEYFVDFTRMVDGF KRL GLSLVERKGFIDFYEDEGRRNPELSKKMGLGCLTREESEVVGIYEVVVFRKLVPES DA
Molecular Weight 34766.49
Target Length 298
Charge 8.0
Number of cysteines 4
Number of Methionine 10
Isoelectric Point 9.1666
MD5 ID (modbase format) 7eca5047a84dea6445b9bcf653f9c172MDSSESDA
Entry Date 2003-11-16
User Name Chris D. Lima

 

Home Proposal Publications Flowchart IceDB Contact