nysgrc-logo Target details for 10097c2BSt4p1_12326_1_27583 protein structure initiative

 

Target ID SGX1000373
Family
Organism Bacillus halodurans
Description
Modification
Sequence SLGEMKRAAIIIDDFGGDVKGVDDFLTGEIPVTVAVMPFLEHSTKQAEIAQAAGLEVIVH MPLEPKKGKISWLGPSGITSNLSVGEVKSRVRKAFDDIPYAVGLNNHMGSKIVENEKIMR AILEVVKEKNAFIIDSGTSPHSLIPQLAEELEVPYATRSIFLDNTHSSRKEVIKNMRKLA KKAKQGSEPIGIGHVGVRGDETYAGIRSMLDEFQAESIQLVPVSQLLPSPIEEDHNKFWQ QPFQAKE
Molecular Weight 27163.12
Target Length 247
Charge -1.5
Number of cysteines
Number of Methionine 7
Isoelectric Point 6.1741
MD5 ID (modbase format) ea36061f0543434031a45b31554e5fcfSLGEQAKE
Entry Date 2006-09-20
User Name Shapiro

 

Home Proposal Publications Flowchart IceDB Contact