nysgrc-logo Target details for 10163b2BSt2p1_12192_1 protein structure initiative

 

Target ID SGX1001583
Family
Organism Methanopyrus kandleri
Description
Modification
Sequence SLKYFKRLSDRERAIFEAGITLGAIYHQFCGTPVSPGTAEEVAKCIERAALLQPCVIDAR VEVDVSSEDTDNYGGYTEVSGRNLRVTIVTRCGEWEAVGKLEFIEELNYPLMWVEEIRRV EQ
Molecular Weight 13803.59
Target Length 122
Charge -6.5
Number of cysteines 4
Number of Methionine 1
Isoelectric Point 4.4653
MD5 ID (modbase format) c2615069ac00cc09d24d375b45c5929dSLKYRVEQ
Entry Date 2006-09-20
User Name S.Almo

 

Home Proposal Publications Flowchart IceDB Contact