nysgrc-logo Target details for 10163b1BCt1p1_12003_1_29812 protein structure initiative

 

Target ID SGX1001583
Family
Organism Methanopyrus kandleri
Description
Modification
Sequence MSLKYFKRLSDRERAIFEAGITLGAIYHQFCGTPVSPGTAEEVAKCIERAALLQPCVIDA RVEVDVSSEDTDNYGGYTEVSGRNLRVTIVTRCGEWEAVGKLEFIEELNYPLMWVEEIRR VEQEGHHHHHH
Molecular Weight 14943.79
Target Length 131
Charge -4.5
Number of cysteines 4
Number of Methionine 2
Isoelectric Point 5.2458
MD5 ID (modbase format) bac4587c48ad874d2930d407e8be052aMSLKHHHH
Entry Date 2006-09-20
User Name S.Almo

 

Home Proposal Publications Flowchart IceDB Contact