nysgrc-logo Target details for 10163b1BCt1p1_12003_1_31184 protein structure initiative

 

Target ID SGX1001583
Family
Organism Methanopyrus kandleri
Description Uncharacterized protein conserved in archaea
Modification
Sequence MSLKYFKRLSDRERAIFEAGITLGAIYHQFCGTPVSPGTAEEVAKCIERAALLQPCVIDA RVEVDVSSEDTDNYGGYTEVSGRNLRVTIVTRCGEWEAVGKLEFIEELNYPLMWVEEIRR VEQEGHHHHHH
Molecular Weight 13716.51
Target Length 121
Charge -6.5
Number of cysteines 4
Number of Methionine 1
Isoelectric Point 4.4653
MD5 ID (modbase format) 1b78ef0314a641f9eaaf90a366ff3b0eLKYFRVEQ
Entry Date 2006-09-18
User Name S.Almo

 

Home Proposal Publications Flowchart IceDB Contact