nysgrc-logo Target details for 10158a1BCt17p1_11868_1 protein structure initiative

 

Target ID SGX1001746
Family
Organism Escherichia coli
Description
Modification
Sequence MSLINEATLAESIRRLRQGERATLAQAMTLVESRHPRHQALSTQLLDAIMPYCGNTLRLG VTGTPGAGKSTFLEAFGMLLIREGLKVAVIAVDPSSPVTGGSILGDKTRMNDLARAEAAF IRPVPSSGHLGGASQRARELMLLCEAAGYDVVIVETVGVGQSETEVARMVDCFISLQIAG GGDDLQGIKKGLMEVADLIVINKDDGDNHTNVAIARHMYESALHILRRKYDEWQPRVLTC SALEKRGIDEIWHAIIDFKTALTASGRLQQVRQQQSVEWLRKQTEEEVLNHLFANEDFDR YYRQTLLAVKNNTLSPRTGLRQLSEFIQTQYFDEGHHHHHH
Molecular Weight 37913.06
Target Length 341
Charge 2.0
Number of cysteines 4
Number of Methionine 9
Isoelectric Point 6.7540
MD5 ID (modbase format) 90fc5c5015a5c9ee1248c750df8980f0MSLIHHHH
Entry Date 2006-09-20
User Name S.Almo

 

Home Proposal Publications Flowchart IceDB Contact