nysgrc-logo Target details for 9355e protein structure initiative

 

Target ID SGX1004491
Family
Organism Unknown
Description
Modification
Sequence MDVDSKTLIHAGKLIDGKSDQVQSRISIVIDGNIISDIKKGFISSNDFEDYIDLRDHTVL PGLMDMHVHFGQEYQSKAQAPIKVEREMQAILATQHAYVTFKSGFTTVRQVGDSGLVAIS LRDAINSGKLAGPRIFAAGKTIATTGGHADPTNGKAVDDYDYPVPEQGVVNGPYEVYAAV RQRYKDGADGIKITVTGGVLSVAKSGQNPQFTQEEVDAVVSAAKDYGMWVAVHAHGAEGM KRAIKAGVDSIEHGTFMDLEAMDLMIENGTYYVPTISAGEFVAEKSKIDNFFPEIVRPKA ASVGPQISDTFRKAYEKGVKIAFGTDAGVQKHGTNWKEFVYMVENGMPAMKAIQSATMET AKLLRIEDKLGSIESGKLADLIAVKGNPIEDISVLENVDVVIKDGLLY
Molecular Weight 44137.02
Target Length 408
Charge -7.0
Number of cysteines
Number of Methionine 13
Isoelectric Point 5.3021
MD5 ID (modbase format) c184c68802df76f74d76d066abc51fc3MDVDGLLY
Entry Date 2006-10-19
User Name

 

Home Proposal Publications Flowchart IceDB Contact