nysgrc-logo Target details for 9355e1BCt10p1_13739_1 protein structure initiative

 

Target ID SGX1004491
Family
Organism Unknown
Description
Modification
Sequence MSLDVDSKTLIHAGKLIDGKSDQVQSRISIVIDGNIISDIKKGFISSNDFEDYIDLRDHT VLPGLMDMHVHFGQEYQSKAQAPIKVEREMQAILATQHAYVTFKSGFTTVRQVGDSGLVA ISLRDAINSGKLAGPRIFAAGKTIATTGGHADPTNGKAVDDYDYPVPEQGVVNGPYEVYA AVRQRYKDGADGIKITVTGGVLSVAKSGQNPQFTQEEVDAVVSAAKDYGMWVAVHAHGAE GMKRAIKAGVDSIEHGTFMDLEAMDLMIENGTYYVPTISAGEFVAEKSKIDNFFPEIVRP KAASVGPQISDTFRKAYEKGVKIAFGTDAGVQKHGTNWKEFVYMVENGMPAMKAIQSATM ETAKLLRIEDKLGSIESGKLADLIAVKGNPIEDISVLENVDVVIKDGLLYEGHHHHHH
Molecular Weight 45346.27
Target Length 418
Charge -5.0
Number of cysteines
Number of Methionine 13
Isoelectric Point 5.9628
MD5 ID (modbase format) fe50bc2555e76506e6f0e0c1df6c8d36MSLDHHHH
Entry Date 2006-12-04
User Name

 

Home Proposal Publications Flowchart IceDB Contact