nysgrc-logo Target details for 6129i1BCt4b1_7223_1 protein structure initiative

 

Target ID SGX_EC013
Family
Organism Agrobacterium tumefaciens
Description AGR_C_1654p
Modification
Sequence MSLSVELRDATVDDLSGIMEIYNDAVVNTTAIWNEVVVDLENRKDWFAARTSRGFPVIVA ILDGKVAGYASYGDWRAFDGYRHTREHSVYVHKDARGHGIGKRLMQALIDHAGGNDVHVL IAAIEAENTASIRLHESLGFRVVGRFSEVGTKFGRWLDLTCMELKLGEGHHHHHH
Molecular Weight 19599.04
Target Length 175
Charge 1.5
Number of cysteines 1
Number of Methionine 4
Isoelectric Point 6.7065
MD5 ID (modbase format) a3f4e5b38010c8799ce063a41addad2cMSLSHHHH
Entry Date 2005-02-02
User Name SGX

 

Home Proposal Publications Flowchart IceDB Contact