nysgrc-logo Target details for 6019b1NYt9b9_6276_1_29409 protein structure initiative

 

Target ID SGX_HI412
Family
Organism Pseudomonas aeruginosa PA01
Description Hypothetical protein PA5201
Modification
Sequence SLDSINTRIAEELSALPSGRVQPQQVAAAVALLDEGSTVPFIARYRKEVTGSLDDTQLRM LEERLRYLRELEERRGAILASIEEQGKLTPELARDIKLADTKTRLEDLYLPYKQKRRTKG QIALEAGLGALADALFDDPTLVPESEAARFVDAEKGFADVKAVLEGAKYILMERFAEDAT LLDKLRVFMKNEATLTARVVPGKEQEGAKFSDYFEHDEPLKSAPSHRALAIFRGRNEGVL SASLKVGEEAPGTLHPCEVMIAQRFGLSNQGRAADKWLAEVVRWTWKVKLYTHLETDLFG ELRDGAEDEAISVFARNLHDLLLAAPAGPRATLGLDPGLRTGVKVAVVDATGKLLDTATV YPHAPKNQWDQTLAVLAALCAKHQVELIAIGNGTASRETDKLAGELIKKYPGMKLTKIMV SEAGASVYSASELAAKEFPELDVSLRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVS QLKLARSLDAVVEDCVNAVGVDVNTASAALLARISGLNSTLAQNIVAHRDANGAFRTRDE LKKVSRLGEKTFEQAAGFLRVMNGDNPLDASAVHPETYPLVQRIAADTERDIRSLIGDSA FLKRLDPKKFTDETFGLPTVTDILKELDKPGRDPRPEFKTAEFQEGVESLKDLKPGMVLE GVVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKDPYEVVKAGDIVKVKVMEVDIPRNRV GLSMRMSDTPGEKVEGQRGGRPTGSGQPRQERGAPRGQSAPPANNAMAALFANAKQLKKK
Molecular Weight 85032.84
Target Length 780
Charge -2.0
Number of cysteines 3
Number of Methionine 12
Isoelectric Point 6.2911
MD5 ID (modbase format) 4e74b10ee7ec04c91861d48d0de27a20SLDSLKKK
Entry Date 2006-12-20
User Name Shapiro

 

Home Proposal Publications Flowchart IceDB Contact