nysgrc-logo Target details for 6019b2BNt_ protein structure initiative

 

Target ID SGX_HI412
Family
Organism Pseudomonas aeruginosa
Description
Modification
Sequence MDSINTRIAEELSALPSGRVQPQQVAAAVALLDEGSTVPFIARYRKEVTGSLDDTQLRML EERLRYLRELEERRGAILASIEEQGKLTPELARDIKLADTKTRLEDLYLPYKQKRRTKGQ IALEAGLGALADALFDDPTLVPESEAARFVDAEKGFADVKAVLEGAKYILMERFAEDATL LDKLRVFMKNEATLTARVVPGKEQEGAKFSDYFEHDEPLKSAPSHRALAIFRGRNEGVLS ASLKVGEEAPGTLHPCEVMIAERFGLSNQGRAADKWLAEVVRWTWKVKLYTHLETDLFGE LRDGAEDEAISVFARNLHDLLLAAPAGPRATLGLDPGLRTGVKVAVVDATGKLLDTATVY PHAPKNQWDQTLAVLAALCAKHQVELIAIGNGTASRETDKLAGELIKKYPGMKLTKIMVS EAGASVYSASELAAKEFPELDVSLRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVSQ LKLARSLDAVVEDCVNAVGVDVNTASAALLARISGLNSTLAQNIVAHRDANGAFRTRDEL KKVSRLGEKTFEQAAGFLRVMNGDNPLDASAVHPETYPLVQRIAADTERDIRSLIGDSAF LKRLDPKKFTDETFGLPTVTDILKELDKPGRDPRPEFKTAEFQEGVESLKDLKPGMVLEG VVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKDPYEVVKAGDIVKVKVMEVDIPRNRVG LSMRMSDTPGEKVEGQRGGRPTGSGQPRQERGAPRGQSAPPANNAMAALFANAKQLKKK
Molecular Weight 84963.80
Target Length 779
Charge -2.0
Number of cysteines 3
Number of Methionine 13
Isoelectric Point 6.2911
MD5 ID (modbase format) 98814b64cbf1fba36152f36fa9a7dcfbMDSILKKK
Entry Date 2008-03-03
User Name

 

Home Proposal Publications Flowchart IceDB Contact