nysgrc-logo Target details for 6019b1NYt9b9_14020_1 protein structure initiative

 

Target ID SGX_HI412
Family
Organism Pseudomonas aeruginosa
Description
Modification
Sequence SLDSINTRIAEELSALPSGRVQPQQVAAAVALLDEGSTVPFIARYRKEVTGSLDDTQLRM LEERLRYLRELEERRGAILASIEEQGKLTPELARDIKLADTKTRLEDLYLPYKQKRRTKG QIALEAGLGALADALFDDPTLVPESEAARFVDAEKGFADVKAVLEGAKYILMERFAEDAT LLDKLRVFMKNEATLTARVVPGKEQEGAKFSDYFEHDEPLKSAPSHRALAIFRGRNEGVL SASLKVGEEAPGTLHPCEVMIAQRFGLSNQGRAADKWLAEVVRWTWKVKLYTHLETDLFG ELRDGAEDEAISVFARNLHDLLLAAPAGPRATLGLDPGLRTGVKVAVVDATGKLLDTATV YPHAPKNQWDQTLAVLAALCAKHQVELIAIGNGTASRETDKLAGELIKKYPGMKLTKIMV SEAGASVYSASELAAKEFPELDVSLRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVS QLKLARSLDAVVEDCVNAVGVDVNTASAALLARISGLNSTLAQNIVAHRDANGAFRTRDE LKKVSRLGEKTFEQAAGFLRVMNGDNPLDASAVHPETYPLVQRIAADTERDIRSLIGDSA FLKRLDPKKFTDETFGLPTVTDILKELDKPGRDPRPEFKTAEFQEGVESLKDLKPGMVLE GVVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKDPYEVVKAGDIVKVKVMEVDIPRNRV GLSMRMSDTPGEKVEGQRGGRPTGSGQPRQERGAPRGQSAPPANNAMAALFANAKQLKKK
Molecular Weight 85031.85
Target Length 780
Charge -1.0
Number of cysteines 3
Number of Methionine 12
Isoelectric Point 6.4155
MD5 ID (modbase format) fa97e8df8b88cb39d2177c3afe453085SLDSLKKK
Entry Date 2008-03-03
User Name Shapiro

 

Home Proposal Publications Flowchart IceDB Contact